PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa009298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family BBR-BPC
Protein Properties Length: 288aa    MW: 31815.2 Da    PI: 9.8549
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58689418PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-15111PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind286.89.5e-8812881289
  GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssia.erdaki..........rernlalsekkaavaerd...........maflqrdkalaernkalverd 78 
                mdddg + rn+gyyep+  +ke+lglqlms ++  rd+k            ++n   s+  aa+++r             ++ +rd++++          
  Lsa009298   1 MDDDGLNMRNWGYYEPS--FKEHLGLQLMSPLTdHRDTKSflssrdnplmMNQNG-ASSMAAAYHHRPqncvvseapipLHY-MRDSWIQR--------- 87 
                9*****99*******99..************9977999999*9977777655555.56677788999977777777776666.77777776......... PP

  GAGA_bind  79 nkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkv 178
                ++ll++l+ + +         + l++++  +s+++++++q ++++++l++    ++   + +  ++  +  +k ++++++pk+++akk++k + ++k++ 
  Lsa009298  88 ERLLHMLPGNPN--------FSLLPDASASNSMHMMQQQQQQQQPIDLPKDTLDDNGGGVGTGGDTGGSGPVK-KRSTTNPKTPRAKKPRKPPGVPKENG 178
                678888885443........56677777777777777788899999988888777777666666666666666.688999***********877776666 PP

  GAGA_bind 179 kkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGyd 278
                 +++  +rsk  k+s+d+v+ng+++D+s++P+PvCsCtGa++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmS+gafkk+LekLa+eGy+
  Lsa009298 179 GNHH-GQRSKVVKRSMDVVINGIDMDISGIPIPVCSCTGAPQQCYRWGSGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSNGAFKKVLEKLASEGYN 277
                6555.68********************************************************************************************* PP

  GAGA_bind 279 lsnpvDLkdhW 289
                ++n++DL+ hW
  Lsa009298 278 FANAIDLRLHW 288
                *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.5E-1321288IPR010409GAGA-binding transcriptional activator
PfamPF062172.3E-971288IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDDDGLNMRN WGYYEPSFKE HLGLQLMSPL TDHRDTKSFL SSRDNPLMMN QNGASSMAAA  60
YHHRPQNCVV SEAPIPLHYM RDSWIQRERL LHMLPGNPNF SLLPDASASN SMHMMQQQQQ  120
QQQPIDLPKD TLDDNGGGVG TGGDTGGSGP VKKRSTTNPK TPRAKKPRKP PGVPKENGGN  180
HHGQRSKVVK RSMDVVINGI DMDISGIPIP VCSCTGAPQQ CYRWGSGGWQ SACCTTTISM  240
YPLPMSTKRR GARIAGRKMS NGAFKKVLEK LASEGYNFAN AIDLRLHW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001268137.11e-118GAGA-binding transcriptional activator BBR/BPC1-like
RefseqXP_010650443.11e-118PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
RefseqXP_010650043.11e-118PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
RefseqXP_010649609.11e-118PREDICTED: GAGA-binding transcriptional activator BBR/BPC1-like isoform X1
SwissprotQ9SKD02e-85BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A124SDN71e-159A0A124SDN7_CYNCS; GAGA binding-like protein
STRINGVIT_01s0011g06380.t011e-117(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-79basic pentacysteine 2